PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 335aa    MW: 36992.2 Da    PI: 8.5636
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10033.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.81.5e-3547105361
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 +++lkcprCdstntkfCyynny+ sqPr+fC+aC+r+WtkGG+lrnvPvGggr++++ +
  KHN10033.1  47 SESLKCPRCDSTNTKFCYYNNYNKSQPRHFCRACKRHWTKGGTLRNVPVGGGRKNKRVR 105
                 5789***********************************************98776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2345103IPR003851Zinc finger, Dof-type
PfamPF027011.7E-3149102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.46550104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGLSSKQVSS SGLDWKQTLL EAQNLELPKP NLMRKQQQQQ QQTQPNSESL KCPRCDSTNT  60
KFCYYNNYNK SQPRHFCRAC KRHWTKGGTL RNVPVGGGRK NKRVRKSITT PITTSSTTTS  120
ITTTTSTCTA TVTTSIGNNN NNMDAMLGCN SHMIIQTPLA DDHKNMSSSL YQALIRPPPL  180
LLQQQNLMNN TRDLEGKDFG IGIGNGNNGI FPSLTLPFPI HHQSQSLLFP FSTSSSSFDT  240
NPCSVVSTSL RSSNVYNYGE DQFKAIEEPT INSTITTTTI VPSTNNTHHP WEIAAATSGV  300
GLGTSSNSNY WNWEDFDSLV STDLKDPWDG SDIKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003542768.10.0PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLA0A0B2PQS90.0A0A0B2PQS9_GLYSO; Dof zinc finger protein DOF3.2
STRINGGLYMA13G25120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-29Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]